Friday, 2 August 2019

‘Hobbs and Shaw’ Writer Chris Morgan Reveals What Dwayne Johnson and Jason Statham Wanted in the Script [Interview]

Hobbs and Shaw - Johnson Statham synchronize

Chris Morgan has written every single Fast and Furious movie since 2006’s The Fast and the Furious: Tokyo Drift, and he’s back as a writer/producer of the franchise’s first spin-off, Fast and Furious Presents: Hobbs and Shaw. But while Morgan had previously written all of his entries solo, this time he has a co-writer in the form of Drew Pearce (Iron Man 3, Mission: Impossible – Rogue Nation).

In a phone interview conducted earlier this week, I spoke with Morgan about how his working relationship with Pearce, the scenes stars Dwayne Johnson and Jason Statham wanted to see in the script, the inspirations for writing this film, taking this franchise into full-on James Bond territory with the villain plot, and more.

Hobbs and Shaw Interview: Chris Morgan

When I spoke with you for The Fate of the Furious, we were talking about how Vin Diesel is such a big collaborator of yours and is a key part of the development process for the Fast and Furious movies. He did not act in or produce Hobbs and Shaw, so was he involved in any of the story conversations about this spin-off?

No, I think they were so focused on [Fast] 9, which was developing at the same time, they had their hands full with that and we had their hands full with this. Fortunately, I have an excellent collaborator in Dwayne Johnson as well. Let me back it up a little bit. When we did Fast 8, remember the sequence in the prison and we played Dwayne and Jason against each other and they went to town on each other throwing insults?

Yes.

That’s the moment that we knew – and the studio knew, specifically – that if we ever wanted to expand the Fast universe, it’s probably with those two guys. They just had a great engine. They respect each other, but man, they hate each other. The characters, that is. One of the things about the Fast films is that they’re always very, very large ensemble pieces, which is awesome, but doesn’t give you a whole lot of time to kinda dig down into characters about where they come from, what are the things that haunt them, what are the things that ground them and make them real sorts of people? Parental troubles, sibling rivalries, all that kind of stuff. So when we fastened in to do this, we really decided to dig in on where does Hobbs come from? Who is his family? Where does Shaw come from? What are his issues with his family? Who are the new characters we haven’t met yet? We got to just dream and play and have fun with these characters who we’ve been living with for a lot of years and then make it personal as well. Specifically for Dwayne, just to be able to bring his Samoan heritage into the film and into such a big, global picture, was really fun.

I’m curious about writing a script for big alpha actors like Johnson and Statham. What sort of stipulations did you get from them or their people when writing this movie? Did they want equal screen time, or was there anything like that which you sort of had to write around when crafting this screenplay?

No, not really. It’s Hobbs and Shaw: you naturally want to balance that screen time just from a story sense anyway. But no, nobody’s counting lines or anything like that. It’s characters that they both love to play, and again, they love to get over on each other. It’s just knowing that we’re going to feed into that with action sequences and fights and some personal – the things that they ask for, generally, are, ‘Can we have a touching moment with my daughter? Can we dig into my family history?’ Those are the things they want to safeguard, and look, they know that we’ve got them handled on all the action front.

To me, this movie is essentially a modern-day remake of Tango and Cash. Was that film a touchstone for you when you set out to write this movie?

(laughs) It is, I love Tango and Cash. Absolutely. That and Butch and Sundance and Lethal Weapon and 48 Hrs. Yeah, all of those are touchstones.

Did you study Tango and Cash structurally?

(laughs) When I was younger! In the theater, a bunch of times. For sure.

How did you approach this from a writing standpoint? As the first spin-off of the franchise, how important was it to step out into new territory while trying to retain a sense that this is an adventure that’s taking place in a world we already know?

Yeah, it’s a balancing act, right? It’s Fast & Furious Presents: Hobbs and Shaw, so you want to make sure that people who love Fast and Furious understand that this does take place in the universe of Fast, in our timeline. The repercussions of this adventure will kind of ring out down the road through Fast. Part of the reason the studio really wanted me on producing and writing and all that was to guarantee that: that Fast feel, that Fast tone. But then also to lend it its own flavor as well so you recognize there’s something slightly different and special in these spin-offs. Largely, it’s the fact that A), we get to dig a little deeper on our characters and their backgrounds, but B) the comedy. For this particular film, there’s a little bit more comedy just because of the energy between Dwayne and Jason. Specifically Hobbs and Shaw, but also Dwayne and Jason, you know?

So yeah, I think as a fan of Fast and someone who’s been involved for a while, I just want to make sure that we are delivering on the same Fast level in terms of the heart, the action, the accepting inclusiveness, globe-trotting. David Leitch came in and he’d just done Deadpool 2 and Atomic Blonde, and his sense is very pop and very fun. He’s a really funny guy, so he just got to ‘plus’ all of those comedic scenes.

This is the first time you have a co-writing credit on one of these films. Did you and Drew Pearce write together, or did he come on board and do a separate pass later? How did that writing relationship work?

It’s great. We were doing it together. Basically what happened was, as we were getting right into production, I’m producing it as well as writing it, and there’s a lot of – we basically just needed extra hands. David had worked with Drew previously, and we came in and got along great, and we just divvied up scenes, divvied up work, and he’d do a pass and I’d come over and vice versa. A positive benefit of that as well is that he’s actually from the UK, so he got to bring some really fun dialogue for the Shaw family that felt a little more authentic.

You mentioned the globe-trotting action earlier. This franchise has been compared to the Bond movies in terms of its scope, but a secret organization that wants to commit genocide in order to replace human weaknesses with mechanical perfection is the most Bond villain plot this franchise has ever seen. What was the thinking behind going that far with the Eteon organization?

Well, in terms of the Bond level of it, I’ll start from the beginning. We have Hobbs and Shaw, who are like these alpha tough guys. We’ve seen them clear a room of bad guys and they’re not daunted by anything. We needed something to actually stand in their way, be so formidable, to beat them down so badly, that these two guys who definitely don’t want to work together – and though they respect each other, they probably hate each other – the only way for them to possibly even try to solve the problem of the movie is to work together to beat Brixton, Idris Elba, in our film.

The reason for the genre shift a little bit – and we’ve done it before also, with Fast Five going into the heist genre – I was just doing a bunch of research on super soldiers and DARPA and future military tech, what they’re working on, where they think they’re going to get. We just decided to give some of those attributes to Brixton to make him incredibly formidable. Also, there’s a little bit of a theme in there of ‘heart vs. tech,’ kind of an old school sort of thing. It turns out that he works for an organization and they’re up to nefarious things. We’re not even sure exactly all the stuff that they’re up to, in terms of the audience, yet. It just seemed like it was fun. It’s a footstep into a slightly different genre, but not too far. It’s five minutes in the future in terms of the actual tech that Brixton is wielding, like the autonomous bike that he has.

Speaking of old school, I have to ask you about Han. He’s not mentioned in this movie, but last time we spoke, you said that you’d been thinking a lot about that character. If Han were to come back in a future Fast movie, would it have to be in flashback form? Or would you entertain the idea that he somehow escaped that explosion in Tokyo?

OK, so there’s a lot of questions in there. Let me start with, there’s a line in this movie from Shaw, right before the ancient weapons battle in Samoa where he’s talking to Hattie and he says, ‘There’s things that I’ve done and there’s things that I have to make amends for.’ That, specifically, he’s referring to Han there. That’s why I wrote it that way.

In terms of Han, I think Han and Shaw – Shaw is going to have one of the greatest arcs of the Fast franchise. It is something that we’ve been talking so long and so much about that we want to be able to devote enough time to it to make it really land. But his is an arc of redemption, of regret. You should just know, in terms of Justice for Han, nobody feels the need for that more than us. Especially Sung Kang as a friend, and we altered the entire timeline of the Fast universe to preserve for three additional movies. Believe me, we are the biggest fans, and I want to make sure that his stuff is resolved really well. I’m just going to just leave the other question in terms of flashback or bringing him back – let’s just see how that story lays out.

Fair enough. I was wondering if Han’s ghost haunted you as you’re writing lines for Deckard Shaw, a character who killed him and got away with it?

It does. Honestly, it does. Han is one of my favorite characters. He started my Fast journey with me in terms of the character and also Sung, you know? That character has been a constant for me, one of my very favorite characters, and someone that I think about often, and exactly how we lay out whatever we reveal in the future with him.

At one point, Shaw points to a Mini Cooper and talks about a “job over in Italy.” Did Deckard Shaw change his name and operate as Handsome Rob from The Italian Job for a while?

I’m just going to leave that there. (laughs) You know what it is? Who knows, but what I will say, I remember we were kitting out Deckard’s lair, and we were looking at the cars. There’s a lot of McLarens, all British cars, and then we were just like, ‘Oh my God, we have to put a Mini Cooper. We have to.’ And they were like, ‘Really?’ and we said, ‘Yes, yes, we must.’ So thank you for noticing that. It’s funny because I love that film and I’m a big fan of it. Who knows what Deckard Shaw has been up to?

Are you going to write Fast 10?

We’ll have to see. Would I? I would, for sure.

What’s the latest on Crime of the Century?

Oh my God, you and me both. I’ve been talking to [director] Dan [Trachtenberg]. Things are in the works. I would just say, just be patient. That’s such an amazing project.

We know it’s a time travel heist film, but can you tell me what’s being heisted? What’s the score that the protagonists are going after?

You know what, I’m going to leave that to Dan, because it’s so personal for him. I don’t want to reveal that for him. I’ll give him the choice on that.

***

Hobbs and Shaw is in theaters now.

Cool Posts From Around the Web:

Thursday, 1 August 2019

Jessica Simpson Is Being Called Out For Dyeing Her Daughter's Hair But Pink Isn't Having It

This isn't the first time that Pink has faced off against the "parent police". Back in April, she said she wouldn't be sharing pictures of her children after she received endless abusive comments over pictures of her son without a diaper on.

Travis Barker Called A Musician "Predatory" After His 13-Year-Old Daughter Shared Screenshots Of Messages He Sent Her

Jean-baptiste Lacroix / AFP / Getty Images

Speaking to the Blast, Travis said: "When I found out a 20-year-old man was trying to get in touch with my 13-year-old daughter by filling her messages with party invites and compliments, I was disgusted. That's predatory behavior, and there is nothing cool, normal, or OK about it at all."

Ariana Grande Reveals Details About New Song "Boyfriend"

right ? we wanted to make something uplifting that captures that feeling of being afraid to take the leap & trust, being afraid of being hurt or feeling like you won’t be enough for that person ... but also how it feels to have a crippling crush on someone. 🖤 #Boyfriendtonight https://t.co/IHQ3cRC9iy

The Daily Telegraph Is Counting People With Fake Email Addresses As Its “Registered Users”

Daily Telegraoh

When he took over as CEO of Britain’s Daily Telegraph in 2017, Nick Hugh laid out ambitious plans involving a strategic pivot for a pro-Brexit newspaper that was facing plummeting circulation.

The former Yahoo and British Telecom executive’s mission, he said, was to focus the 164-year-old publication not on selling papers, or counting subscribers, clicks, and views, but rather to accumulate 10 million “registered users” online as soon as possible.

“Registration is the tide that lifts all boats,” Hugh told the Financial Times in December that year.

Hugh made the case that “being able to understand who your users are” was a vital ingredient for success. “A registered reader — as opposed to an anonymous one — is far more valuable to the business than the vast majority of our audience as it stands now,” he declared — a line that later appeared verbatim in the Telegraph’s corporate “vision” displayed prominently on the company’s website.

Since then, Hugh has repeatedly talked up the Telegraph’s progress – positioning the number of “registered users” (or "registered customers") as the yardstick by which the publication’s fortunes should be judged. Last August, in a rare tweet, he announced that it had hit its 2018 target of 3 million registrations.

In line with our vision @Telegraph today we hit our 2018 target of 3 million registrations, 4 months ahead of schedule! We owe this incredible milestone to our continuously outstanding journalism and the hard work and dedication of everybody here. A truly fantastic achievement.

But BuzzFeed News can reveal that the Telegraph makes no attempt to authenticate the email addresses used in the registration by asking the user to confirm in a follow-up email. That raises serious questions over how many of Hugh’s much-vaunted registered users are legitimate.

Like many other premium news websites, visitors to the Telegraph.co.uk hit a paywall when they visit an article. To access it, they’re asked to register with an email address and a password to become a registered user.

We created more than a dozen registered user accounts with fake emails ⁠— each one was accepted as a registered user with no questions asked, and each account has continued to access the Telegraph website over a period of several weeks. Among others, names like "Fakey McFake" tied to the email this_is_not_real_daily_telegraph@gmail.com and "I’m Not Real Won’t Have To Verify Either" with the email address thisisafakeemaildailytelegraph@gmail.com.

Tristan Fewings

Nick Hugh (right) while attending a marketing conference in 2016.

A Telegraph spokesperson admitted the publication doesn’t check whether its registered users have real email addresses.

“As a subscription-first business, registration is the first step on the way to becoming a subscriber,” they said in a statement in response to a series of questions.

“In order to create a smooth registration experience, The Telegraph does not authenticate email addresses at the first point of entry, instead the email database is routinely reviewed for any inaccuracies.”

But BuzzFeed News spoke to several experts and industry insiders at similar mainstream publications who said it wasn’t a normal practice to count unauthenticated email addresses as “registered users”. None said they had seen anything like it before.

Brian O’Kelley, the founder of digital ad exchange company AppNexus, who was once called the “King of Ad Tech” by Forbes magazine, told BuzzFeed News over email: “I haven’t seen this behaviour elsewhere. It’s very surprising if they don’t do a simple verification process: ‘We just sent you an email / text, please click on it to validate your email.’

“I’m sure they see a lot of drop-off in visits if they validate, which of course costs them ad revenue. That said, using unvalidated email numbers in any way as ‘registered’ would be ridiculous.”

Michael Stephens / AFP / Getty Images

Sir David Barclay and his twin brother Sir Frederick posing after receiving their knighthoods from the Queen at Buckingham Palace, 2000.

The Daily Telegraph — nicknamed the Torygraph for its conservative values, views, and status among the party’s traditional base – is owned by the Barclay brothers, the billionaire twins whose property, media, and retailing fortune was this year valued at £8 billion by the Sunday Times Rich List.

Since buying the paper for £665 million in 2004, the twins have faced repeated criticism for the way they’ve run it. In 2008, a memo written by the eminent former Telegraph editor Bill Deedes was published referring to the new management as a “stinking mob,” who were taking the title downmarket after cuts.

There have been huge victories for its journalism, like the MPs’ expenses scandal in 2009 and its “Football for Sale” sting in 2016, but there have also been hits to the editorial credibility of the newspaper. In 2015, chief political commentator Peter Oborne resigned over what he claimed was the Telegraph’s deliberate suppression of negative stories about HSBC bank because it was a major advertiser.

Last year, the Times reported the Barclay brothers had continued to write down the value of the newspaper group, while also taking a hefty dividend for themselves. This year, the news group’s profits were halved as newspaper circulation plummeted.

It’s led to buyers reportedly circling. According to the FT, the Russian owner of the Independent and Evening Standard, Evgeny Lebedev, and another Fleet Street consortium came knocking in 2016. Amazon founder and Washington Post owner Jeff Bezos's name has also been floated several times as someone who could be interested in the paper. The twins continue to say the newspaper is not for sale.

Handout / Paul Grover/The Daily Telegraph

Boris Johnson addresses the Daily Telegraph readers during the Conservative Party leadership race this year.

The Telegraph has also been hit harder than most by the industrywide crash in newspaper circulation. According to ABC Newsbrand data, at the start of 2000, the Telegraph was averaging more than 1 million copies per day — easily the highest circulating UK broadsheet newspaper in its category. By 2017 — the year that new CEO Nick Hugh took over — the publication’s circulation had more than halved to 484,000.

A year later, it was 371,000 — much of which was due to Hugh’s strategic decision to end the process of handing out free copies, knowns as bulks, during events and at places like airports, which the CEO said came to 67,000 copies a day. ABC’s most recent survey shows the Telegraph’s daily circulation had slid even further to 327,000.

Carl De Souza / AFP / Getty Images

Commuter reads a copy of the Daily Telegraph in front of their offices in 2004.

Douglas McCabe from Enders Analysis told BuzzFeed News that Hugh’s arrival had brought a “radical shift” in its effort to get digital readers in the face of these problems with the paper’s finances and circulation.

But when asked about the Telegraph’s push into a “registration-first” strategy, McCabe warned of a premium title courting a mass audience.

“Nick Hugh’s approach is a radical shift from where the Telegraph was going: a pivot to an online subscription model that will require considerable investment in the near and medium term — investment in technology, data analytics, and journalism itself — all of which will have a material impact on profitability.

“So, for example, premium content subscription services should not be excessively focused on mass-market audience acquisition. Such an approach makes the conversion to long-term loyal subscribers more complicated (and would be a distraction for journalists). The focus should be on relentlessly serving a narrower core audience (a few million people) with the content and services that audience specifically desires from the media brand.

“Loyal users are the only people that should be tracked, not random visitors.”

Hugh has shrugged off the newspaper’s circulation nose dive by giving an upbeat interview to the Drum about its success with registered users: “I am positively amazed at our progress”, calling it both a “truly fantastic achievement” and an “incredible milestone”.

A senior source at a major US publication in charge of reader strategy, who spoke to BuzzFeed News on the condition of anonymity, called the Telegraph’s approach “bizarre”.

“The simple reason for a registration strategy is to get readers’ email addresses in order to market things to them — products, the store, and especially subscriptions,” they said.

“If they’re not authenticating the registered users by sending them an email, and getting them to click through to confirm, how many of them are real people would be a complete mystery. Why have someone go through this process if you’re not going to use it to drive subscriptions?”

The Daily Telegraph still gets information about who arrives on its website through the use of cookies, which can be used in advertising and marketing. But the source said not verifying registered users was an "oversight".

“I mean, it looks a pretty blatant technical oversight. Regardless, in this business, it’s just not efficient, like, at all.”

One Telegraph insider had a more blunt assessment. “They don’t verify the email addresses, so you’ve got readers jamming in random names to get access behind the paywall,” they told BuzzFeed News. “What, then you have the hide to count them as your valued readers?

“It’s like they’re the CEO of McDonald's admitting they put dog food in the burgers — ‘I mean, yes, our central business proposition is shit, and that is a problem.’"

Tana Mongeau's Reality Show Just Revealed Some Very Interesting Things About Her Marriage To Jake Paul

Jake and Tana first started appearing in each other's YouTube videos at the end of April, just a couple of days after Tana's very public split from her ex-boyfriend Brad.

As they began spending more and more time together — and referring to themselves as "Jana" — people wondered whether their public relationship was real, or whether it was just for ~clout~. Honestly, it's never been clear.

The "Modern Family" Cast Shared Emotional Tributes To The Show On The First Day Of The Final Season

"Spot the differences," Nolan Gould wrote. "The top photo was taken on the day of our first table read, 11 years ago. Today was the last of our first table reads. Excited to be spending one more season with the best TV family and crew."